PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c25_3170V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 487aa    MW: 53579.6 Da    PI: 5.7276
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c25_3170V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++lv +++++G g+W++ +++ g+ R++k+c++rw +yl
  Pp3c25_3170V3.2.p 15 KGPWTPDEDQKLVAYIQEHGHGSWRALPEKAGLARCGKSCRLRWTNYL 62
                       79********************************************97 PP

2Myb_DNA-binding54.13.5e-1768113148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr++ eEd+ ++++++ lG++ W++Ia +++  Rt++++k++w+++l
  Pp3c25_3170V3.2.p  68 RGRFSHEEDQMIIQLHAILGNR-WSAIAGHLP-QRTDNEIKNYWNTHL 113
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0521062IPR017930Myb domain
SuperFamilySSF466896.24E-3112109IPR009057Homeodomain-like
SMARTSM007171.6E-131464IPR001005SANT/Myb domain
PfamPF002493.0E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-241669IPR009057Homeodomain-like
CDDcd001671.89E-111762No hitNo description
PROSITE profilePS5129426.40663117IPR017930Myb domain
SMARTSM007172.9E-1667115IPR001005SANT/Myb domain
PfamPF002491.8E-1568113IPR001005SANT/Myb domain
CDDcd001675.04E-1270113No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MGRAPCCDEK LSLKKGPWTP DEDQKLVAYI QEHGHGSWRA LPEKAGLARC GKSCRLRWTN  60
YLRPDIKRGR FSHEEDQMII QLHAILGNRW SAIAGHLPQR TDNEIKNYWN THLKKRLAHR  120
GIDPVSHKTS SAGLALASSW RPLVSTQLTH TTQWDCALAE AEARLSKTSS IKLLSKESDT  180
TPAATHPSAY FMRSWKTGVE DTLKPQFGPV KLESFSSVRI NCSTPIPKPV SRPSKILQDW  240
DSVLGPRHDL PNPFWQNSGA LALTHALKQF SVGRMNSFRV EPAAPPQARS NSFGASGEAM  300
SSSLAEIMFT GIDHQRSPDS TPGFPAAAEA ARSDGFDLDD GVAPEDYFSP NSTLHGPDSD  360
LTPSDSGSPC GSADESTSDY FEFALHQQHG FFHSFPPLPG GADHQDESPM STIPDTFWHE  420
DQHDSGRLQI HNVAPDGVVP ESGGLELIIP MDFSTAEFSH QFESLCQEVE EEEPMQQDPA  480
VCDNIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131175108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.20640.0gametophore
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001782292.10.0predicted protein, partial
TrEMBLA9TUL30.0A9TUL3_PHYPA; Predicted protein (Fragment)
STRINGPP1S326_37V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-82myb domain protein 16